PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00137167001
Common NameGSBRNA2T00137167001, LOC106380388
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 156aa    MW: 17563.1 Da    PI: 8.1639
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00137167001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601231.6e-38171161100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          aCaaCk++r+kC+++C+la+yfp+e++++f n+hklFG+sn++k++k ++e +r++am+ l+++A+arardPv G+++++l+l++q++++
  GSBRNA2T00137167001  17 ACAACKYQRKKCTEHCILARYFPQEKQNQFLNAHKLFGVSNITKFIKGVEECQRDIAMNNLIFHANARARDPVWGVCKIMLDLKHQIACT 106
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          +ael+l++++
  GSBRNA2T00137167001 107 QAELNLVHHQ 116
                          *******997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512575118No hitNo description
PROSITE profilePS5089123.75416117IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-3517114IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 156 aa     Download sequence    Send to blast
MSLSKFHGGS SSSSTTACAA CKYQRKKCTE HCILARYFPQ EKQNQFLNAH KLFGVSNITK  60
FIKGVEECQR DIAMNNLIFH ANARARDPVW GVCKIMLDLK HQIACTQAEL NLVHHQNLAM  120
CQTIALQQQF GCYSYGDLLE QGDEYLNIDG HVHQK*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00137167001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013619887.11e-115PREDICTED: LOB domain-containing protein 7
RefseqXP_013675601.11e-115PREDICTED: LOB domain-containing protein 7-like
SwissprotQ9SSM92e-59LBD7_ARATH; LOB domain-containing protein 7
TrEMBLA0A078CY731e-114A0A078CY73_BRANA; BnaC02g21690D protein
TrEMBLA0A0D3AQ801e-114A0A0D3AQ80_BRAOL; Uncharacterized protein
STRINGBra008062.1-P1e-96(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM154661417
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72980.11e-52LOB domain-containing protein 7
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]